PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008220756.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 382aa    MW: 42277.2 Da    PI: 7.6279
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008220756.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM61.33.1e-19111174128
             NAM   4 GfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                      + F+ tdeel    L k ++g++l+  +vi++++ y++ P++Lp      +  wyf +++++k          t+ gyW+++g+  +++s +++
  XP_008220756.1  11 DIGFQCTDEELC-ISLGKIISGSPLPG-NVIEDANPYQLVPSNLP------DGFWYFIHSNENK---------PTNFGYWRTKGEACRIFS-NSS 87 
                     56799******9.66***********9.99**************9......3568888887654.........4778**************.999 PP

             NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                      +g + tL fy+g+ap+ +kt+Wvm+ey l
  XP_008220756.1  88 ITGWRATLEFYQGHAPHESKTNWVMQEYWL 117
                     ****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-267140IPR003441NAC domain
PROSITE profilePS5100526.9068140IPR003441NAC domain
PfamPF023651.1E-1011116IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MRPQSAALPA DIGFQCTDEE LCISLGKIIS GSPLPGNVIE DANPYQLVPS NLPDGFWYFI  60
HSNENKPTNF GYWRTKGEAC RIFSNSSITG WRATLEFYQG HAPHESKTNW VMQEYWLTQK  120
KLSEDSKAKE PRSLCRVFCS NEQKSNCKNL QKMVSSDSAS YSTHSAVPRA KNCTSHSSTS  180
KPQVIKDNER GTLIGTERGP DHNVQIMPEI DYVSRGDYLE LLDLDTPASF SFSSDSSCLT  240
MSSDECFDSL ALLEELEPKN SQDLVNKNAG CKFSISAPPR SDELVMFAAS SGSFSKSPSE  300
ERVKTHSPIP GSAVCGKISG KTSNNMSRIQ KPDNRNEGGP STSHNIDVSP SSNTASQEGK  360
RRARTIGRTE KLKKKYFCFM PF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008220756.10.0PREDICTED: protein SOMBRERO-like
RefseqXP_008220757.10.0PREDICTED: protein SOMBRERO-like
TrEMBLM5XEE40.0M5XEE4_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105882235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.15e-20NAC domain containing protein 28